Protein Labeling Reagents
Biotium VivoBrite™ Rapid Antibody Labeling Kit for Small Animal In Vivo Imaging, CF770 SE
This labeling kit comprises our superior near-IR amine-reactive CF dye and other components necessary for carrying out antibody labeling, purification, and filter sterilization. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Near-infrared fluorescent CF770 dye has excitation/emission at 770/797 nm.
Biocare Medical, LLC Reveal Decloaker, 10X - 500 ml
Reveal Decloaker is a heat retrieval solution that is suitable for most antibody-antigen staining and reduces non-specific background staining, blocks endogenous peroxidase and removes mercury crystals. Reveal Decloaker can be used with Biocare's digital electric pressure cooker (Decloaking Chamber), a steamer, a water bath, or a microwave oven. For many antibodies, titers are doubled and background staining is significantly reduced when compared to citrate buffer, pH 6.0. Reveal Decloaker incorporates Assure technology, a color-coded high temperature pH indicator solution. The end-user is assured by visual inspection that the solution is at the correct dilution and pH. This product is specially formulated for superior pH stability at high temperatures and will help prevent the possibility of losing pH sensitive antigens. Reveal Decloaker is non-toxic, non-flammable, odorless and sodium azide and thimerosal free.
Medchemexpress LLC Cy7-yne | 95.0% | 10 MG
Cy7-YNE is a near-infrared cyanine fluorescent labeling reagent containing an alkyne functional group for click chemistry and conjugation to biomolecules. It is used to label proteins, antibodies, and peptides for fluorescence-based detection in the ~700-790 nm spectral region.
- Near-infrared cyanine dye suitable for biomolecule labeling.
- Contains an alkyne group for copper-catalyzed azide-alkyne cycloaddition (CuAAC).
- Optimized for excitation around 700-770 nm and emission near 770-790 nm.
- Available in milligram pack sizes for research use.
- Solid form with ≥95.0% purity.
- Store protected from light; in solvent: -80°C for long-term, -20°C for short-term.
Abcam NBD- x , SE, 25MG
MW 391.34 Da, Purity >90%. Lipophilic green fluorescent probe for labeling antibodies and proteins. X-spacer provides separation between dye and protein for increased sensitivity and reduced impact on protein function. Functional analog of the dinitrophenol (DNP) hapten. Fluorescence is quenched when bound by anti-DNP antibodies.
The product is subject to the following: Abcam Restricted Use Statement
Medchemexpress LLC HY-D0723 10mg Medchemexpress, 5(6)-TAMRA SE CAS:246256-50-8 Purity:>98%
Medchemexpress, HY-D0723 10mg 5(6)-TAMRA SE CAS:246256-50-8 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Bioworld Glow Cyanoblue Dye, 5 mL
Premixed and ready-to-load gel dyes. Glow Loading Dyes generate intense DNA/RNA bands with little background or band distortion and can be used with any type of agarose or acrylamide gels. Glow CyanoBlue dye contains bromophenol blue and xylene cyanol in a ficoll-based solution with ethidium bromide (6X concentration).
CPC Scientific TAMRA-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (trifluoroacetate salt) 0.5MG
Brain natriuretic peptide or B-type natriuretic peptide (BNP) (also ventricular natriuretic peptide) is a 32-amino acid peptide secreted by heart ventricles in response to excessive stretching of heart muscle cells (cardiomyocytes).ONE-LETTER SEQUENCE: TAMRA-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Cys10 and 26 bridge)MOLECULAR FORMULA: C168H266N52O46S4MOLECULAR WEIGHT:3878.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [114471-18-0], RESEARCH AREA: CardiovascularREFERENCES: T. Sudoh et al., BBRC, 159, 1427 (1989)
Vector Laboratories NEUROBIOTIN Tracer
NEUROBIOTIN Tracer (SP-1120) is an amino derivative of biotin that can be used as an intracellular label for cells, particularly neurons. It is used for visualizing neural architecture and for the identification of gap junction coupling. Can be used in many types of preparations including in vivo, whole mounts, slice preparations, or cultured cells - Can be delivered by many routes such as intracellular electrodes, microinjection, cut-loading, or scrape-loading - Can be detected using avidin or streptavidin systems with either chromogenic or fluorescence visualization methods
Agilent Technologies GLY-X VACUUM MANIFOLD SPACER
Gly-X Vacuum Manifold Spacer (2-pack) The Gly-X Vacuum Manifold Spacer ensures precise fitment of Gly-X components in the recommended Millipore MSVMHTS00-HTS vacuum manifold. Includes 2 reusable spacers.
Medchemexpress LLC HY-D0818 5mg Medchemexpress, CY3-YNE CAS:1010386-62-5 Purity:>98%
Medchemexpress, HY-D0818 5mg CY3-YNE CAS:1010386-62-5 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Medchemexpress LLC Cyanine5 NHS ester (iodide) | 00-00-0 | 98.0% | C36H42IN3O4 | 10MG
Cyanine5 NHS ester iodide is an amine-reactive, red-emitting fluorescent dye for covalent labeling of primary amino groups in peptides, proteins, and oligonucleotides. Supplied as a solid NHS-ester with an iodide counter-ion, it is characterized for research use with COA, SDS, HNMR, and LCMS documentation to support conjugation and analytical workflows.
- Red emission suitable for near-infrared fluorescence detection.
- Amine-reactive NHS ester for covalent labeling of primary amines.
- High purity supporting consistent conjugation performance.
- Available in multiple small-scale pack sizes for research use.
- Characterized by COA, HNMR, and LCMS documentation.
LICOR IRDye 680RD Carboxylate (100 nmol)
Assays that use IRDye 680RD conjugates (such as small animal imaging and cell binding assays) may require a "dye-only" control for potential effects or retention of the dye. Carboxylate (non-reactive) form of IRDye 680RD is an ideal control.
Biotium Mix-n-Stain™ CF660C Small Ligand Labeling Kit
Mix-n-Stain™ Small Ligand Labeling Kits are designed for rapid labeling of low molecular weight (MW 150 -5000) ligands without a purification step. Suitable ligands or substrates include SNAP-tag, CLIP-tag™ and HaloTag ligand derivatives that have an aliphatic amine. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Far-red fluorescent CF660C dye has excitation/emission at 667/685 nm. It is suitable for labeling ligands for cell surface staining.
Aat Bioquest 5-TAMRA, SE [5-Carboxytetramethylrhodamine, succinimidyl ester] *CAS#: 150810-68-7*
The single TAMRA isomers are increasingly preferred for labeling peptides and nucleotides because they give better resolution in HPLC purification that is often required in the conjugation processes.
Medchemexpress LLC HY-D0053 5mg Medchemexpress, 6-ROX CAS:194785-18-7 Purity:>98%
Medchemexpress, HY-D0053 5mg 6-ROX CAS:194785-18-7 Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.